Free ShippingFree Ship$250+
Same-Day Processing
99%+ PurityGuaranteed
Research Only
VIP 10mg
| CAS Number | 40077-57-4 |
| Molecular Formula | C147H238N44O42S |
| Molar Mass | 3325.8 g/mol (or approximately 3326 g/mol) |
| Sequence | His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Synonyms | Vasoactive Intestinal Peptide, Vasoactive Intestinal Polypeptide, VIP |
| Purity | ≥95–99% (HPLC); research-grade often ≥98% or ≥99% |
| Form | Lyophilized powder (white to off-white) |
| Storage | −20°C (long-term, lyophilized, desiccated); 2–8°C (reconstituted, short-term); protect from light and moisture; avoid repeated freeze-thaw cycles |
| Solubility | Soluble in sterile water, bacteriostatic water, or saline (typically ≥1–20 mg/mL; gentle agitation recommended; may form alpha-helical structure in certain solvents) |
