LL-37 antimicrobial peptide is the active 37-amino-acid fragment derived from the human cathelicidin hCAP18. Its cationic structure has made it an important subject in antimicrobial and innate immune research.

Studies have investigated LL-37's interactions with microbial membranes, host cells, and immune signaling pathways. Research has also examined its involvement in tissue repair and cellular migration.

Results should be interpreted according to the specific experimental model and study conditions.

How LL-37 Is Studied

A LL-37 research peptide may be examined in controlled biochemical, cellular, and preclinical models involving:

• Antimicrobial activity
• Microbial membrane interactions
• Innate immune signaling
• Cell migration
• Wound-healing pathways
• Angiogenesis-related mechanisms
• Inflammatory responses
• Tissue remodeling

Qualified researchers should select appropriate models, analytical methods, controls, and experimental conditions according to validated laboratory protocols.

Key Research Areas

Antimicrobial research

LL-37 has been studied for activity against a range of microorganisms, including bacteria and fungi, making it a useful subject for antimicrobial mechanism research.

Wound-healing research

Preclinical studies have investigated LL-37 in relation to cell migration, re-epithelialization, angiogenesis, and other processes associated with tissue repair.

Immune signaling

Research has examined LL-37's interaction with innate immune pathways and its potential role in regulating inflammatory signaling.

Tissue research

Researchers have also investigated LL-37 in cellular models involving tissue remodeling and host-microbe interactions.

Why Choose LL-37?

This LL-37 wound healing peptide research material provides a defined peptide sequence for laboratory investigation.

• Defined 37-amino-acid sequence: Clearly identifies the research peptide.
• High stated purity: ≥99% by HPLC.
• Documented specifications: Includes CAS number, molecular formula, molar mass, and sequence.
• Lyophilized format: Supports organized laboratory storage.
• Research-focused: Intended for controlled experimental studies.

When comparing lab tested peptides for sale, researchers should review peptide identity, sequence, purity, analytical documentation, storage requirements, and research-use labeling.

Storage and Laboratory Handling

LL-37 should be stored according to the supplied product documentation. The listed specification recommends −20°C (−4°F) for long-term storage and 2–8°C (36–46°F) after reconstitution.

Protect the material from excessive heat, moisture, and direct light. Preparation, measurement, and analytical handling should be performed by appropriately trained laboratory personnel using established laboratory safety procedures.

Selecting LL-37 for Research

Researchers considering LL-37 peptide buy options should verify the peptide identity, sequence, stated purity, analytical documentation, physical form, and intended research use.

When evaluating an antimicrobial peptide for sale, researchers should prioritize clear product specifications and supporting quality documentation. Terms such as best peptide for immune research describe a research interest rather than an established ranking or clinical recommendation.

Those searching to Buy LL-37 online should also confirm that the material is clearly labeled for laboratory research and meets their experimental requirements.

Frequently Asked Questions

What is LL-37 peptide?

LL-37 is a 37-amino-acid cationic peptide derived from the human cathelicidin precursor hCAP18. It is widely studied in antimicrobial, immune, and tissue-related research.

What is LL-37 studied for?

Research has examined LL-37 in antimicrobial activity, innate immune signaling, cell migration, wound-healing pathways, angiogenesis, and tissue remodeling.

What is the purity of LL-37?

The listed specification states ≥99% purity by HPLC.

What is the LL-37 sequence?

The sequence is [LL-37, 37 aa]

How should LL-37 be stored?

The listed specification recommends −20°C (−4°F) for long-term storage and 2–8°C (36–46°F) after reconstitution.

Is LL-37 intended for human use?

No. This product is supplied strictly for laboratory research and is not intended for human or veterinary administration or consumption.

What should I look for in an LL-37 peptide supplier?

Review the peptide identity, sequence, purity, analytical documentation, storage information, packaging, and research-use designation.

Can I buy LL-37 research peptide online?

Research materials may be available through laboratory suppliers. Researchers should verify product specifications, documentation, intended research use, and applicable requirements before purchasing.

Research Use Notice

LL-37 is supplied for research use only. It is not approved for human or veterinary use and should not be represented as a therapeutic, diagnostic, antimicrobial treatment, wound-healing product, or consumer product.

Researchers are responsible for complying with applicable laws, institutional requirements, laboratory procedures, and appropriate safety practices.

This statement has not been evaluated by the U.S. Food and Drug Administration. This product is not intended to diagnose, treat, cure, or prevent any disease.