LL-37
$45
In Stock99%+ Pure
Lab Tested
Fast Shipping
For laboratory research use only — not for human or animal consumption.
Description
LL-37
LL-37 is a 37-amino acid cationic antimicrobial peptide derived from human cathelicidin hCAP18. Preclinical research explores its antimicrobial, wound healing, and immunomodulatory properties in various infection and tissue repair models.
Key Research Areas
- • Studied for potent broad-spectrum antimicrobial activity against bacteria, fungi, and some viruses in infection models.
- • Investigated for promotion of wound healing through enhanced cell migration, angiogenesis, and re-epithelialization.
- • Explored for immunomodulatory effects including anti-inflammatory actions and regulation of innate immune responses.
Product Specifications
| Product | LL-37 |
| CAS Number | 154947-66-7 |
| Molecular Formula | C205H340N60O53 |
| Molar Mass | 4493.3 g/mol |
| Sequence | [LL-37, 37 aa] |
| Synonyms | LL-37; Cathelicidin LL-37; hCAP18-derived peptide; Ropocamptide |
| Purity | ≥99% (HPLC) |
| Form | Lyophilized powder |
| Storage | −20°C (−4°F) long-term; 2–8°C (36–46°F) reconstituted |
| Solubility | Bacteriostatic water for laboratory use |
All products offered by Premier Research are intended for laboratory research use only. These materials are not for human or veterinary consumption, medical use, diagnostic procedures, or therapeutic applications. Statements on this website are for informational and educational purposes only and have not been evaluated by the U.S. Food and Drug Administration (FDA). By accessing this site, you confirm that you are a qualified researcher or institution representative and agree to use all materials in accordance with applicable laws, regulations, and safety guidelines.
Categories
PEPTIDES