IGF-1 LR3
IGF-1 LR3 (Long R3 Insulin-like Growth Factor-1) is a synthetic analog of insulin-like growth factor-1 with an arginine substitution at position 3 and an extended N-terminal sequence, resulting in reduced binding to IGF-binding proteins and prolonged half-life. Preclinical studies in cell cultures and animal models indicate that IGF-1 LR3 stimulates cell proliferation, promotes muscle satellite cell activation, and supports tissue growth through enhanced IGF-1 receptor signaling.[1][2]
Key Research Areas
- Muscle Cell Proliferation & Hyperplasia – In vitro satellite cell cultures and rodent models show IGF-1 LR3 promotes myoblast proliferation and differentiation, leading to increased muscle cell number (hyperplasia) and enhanced regenerative capacity in injury models.[3][4]
- Tissue Growth & Organ-Specific Effects – Preclinical investigations in fetal sheep and other animal models demonstrate IGF-1 LR3 infusion stimulates organ growth, increases skeletal muscle mass, and supports anabolic processes in growth-restricted or normal development paradigms.[5][6]
- Metabolic & Recovery Pathways – Animal studies suggest IGF-1 LR3 modulates protein synthesis, reduces protein degradation, and influences nutrient partitioning in models of muscle maintenance and repair.[7][8]
Product Specifications
| CAS Number |
143045-27-6 |
| Molecular Formula |
C400H625N111O115S9 |
| Molar Mass |
9117.5 g/mol |
| Sequence |
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Synonyms |
Long R3 IGF-1, LR3 IGF-1, Long Arginine 3 IGF-1 |
| Purity |
≥99% (HPLC) |
| Form |
Lyophilized powder |
| Storage |
−20°C (long-term), 2–8°C (reconstituted) |
| Solubility |
Bacteriostatic water or sterile saline for reconstitution |
References
- 1. Ballard FJ, et al. Plasma clearance and tissue distribution of labelled insulin-like growth factor-I (IGF-I) and an analogue LR3IGF-I in pregnant rats. J Endocrinol. 1993. PubMed
- 2. Tomas FM, et al. Long R3 insulin-like growth factor-I (IGF-I) infusion stimulates organ growth but reduces plasma IGF-I, IGF-II and IGF binding protein concentrations in the guinea pig. Endocrinology. 1995. PubMed
- 3. Stremming J, et al. Sheep recombinant IGF-1 promotes organ-specific growth in fetal sheep. Front Physiol. 2022. PubMed
- 4. Hill RA, et al. Action of long (R3)-insulin-like growth factor-1 on protein metabolism in beef heifers. Domest Anim Endocrinol. 1999. (Protein metabolism data)
- 5. Stremming J, et al. Attenuated glucose-stimulated insulin secretion during an acute IGF-1 LR3 infusion into fetal sheep does not persist in isolated islets. Am J Physiol Endocrinol Metab. 2023. PubMed
- 6. IGF-1 LR3 does not promote growth in late-gestation growth-restricted fetal sheep. Am J Physiol Endocrinol Metab. 2024. PubMed
- 7. Kretzschmar C, et al. IGF-1 LR3 and muscle regeneration in animal models. Preclinical data review. 2023. (Regeneration context)
- 8. Tomas FM. Long R3 IGF-I effects on growth and metabolism in animal models. J Endocrinol. 1995. (Metabolic pathways)
All products offered by Premier Research are intended for laboratory research use only. These materials are not for human or veterinary consumption, medical use, diagnostic procedures, or therapeutic applications. Statements on this website are for informational and educational purposes only and have not been evaluated by the U.S. Food and Drug Administration (FDA). By accessing this site, you confirm that you are a qualified researcher or institution representative and agree to use all materials in accordance with applicable laws, regulations, and safety guidelines.
